PFKFB4 antibody

Name PFKFB4 antibody
Supplier Fitzgerald
Catalog 70R-3800
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PFKFB4 antibody was raised using the N terminal of PFKFB4 corresponding to a region with amino acids MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR
Purity/Format Affinity purified
Blocking Peptide PFKFB4 Blocking Peptide
Description Rabbit polyclonal PFKFB4 antibody raised against the N terminal of PFKFB4
Gene PFKFB4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.