SECTM1 antibody

Name SECTM1 antibody
Supplier Fitzgerald
Catalog 70R-6758
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SECTM1 antibody was raised using the middle region of SECTM1 corresponding to a region with amino acids ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV
Purity/Format Affinity purified
Blocking Peptide SECTM1 Blocking Peptide
Description Rabbit polyclonal SECTM1 antibody raised against the middle region of SECTM1
Gene SECTM1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.