| Name | IRF6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1620 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | IRF6 antibody was raised using the C terminal of IRF6 corresponding to a region with amino acids FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | IRF6 Blocking Peptide |
| Description | Rabbit polyclonal IRF6 antibody raised against the C terminal of IRF6 |
| Gene | IRF6 |
| Supplier Page | Shop |