| Name | GLMN antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5818 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYL |
| Purity/Format | Affinity purified |
| Blocking Peptide | GLMN Blocking Peptide |
| Description | Rabbit polyclonal GLMN antibody raised against the middle region of GLMN |
| Gene | GLMN |
| Supplier Page | Shop |