Name | SEMA3D antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6406 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS |
Purity/Format | Affinity purified |
Blocking Peptide | SEMA3D Blocking Peptide |
Description | Rabbit polyclonal SEMA3D antibody raised against the middle region of SEMA3D |
Gene | SEMA3D |
Supplier Page | Shop |