SEMA3D antibody

Name SEMA3D antibody
Supplier Fitzgerald
Catalog 70R-6406
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Purity/Format Affinity purified
Blocking Peptide SEMA3D Blocking Peptide
Description Rabbit polyclonal SEMA3D antibody raised against the middle region of SEMA3D
Gene SEMA3D
Supplier Page Shop