| Name | FGG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7144 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | FGG Blocking Peptide |
| Description | Rabbit polyclonal FGG antibody raised against the middle region of FGG |
| Gene | FGG |
| Supplier Page | Shop |