Name | PITPNB antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3832 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA |
Purity/Format | Affinity purified |
Blocking Peptide | PITPNB Blocking Peptide |
Description | Rabbit polyclonal PITPNB antibody raised against the middle region of PITPNB |
Gene | PITPNB |
Supplier Page | Shop |