Name | ANKRD47 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3287 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR |
Purity/Format | Affinity purified |
Blocking Peptide | ANKRD47 Blocking Peptide |
Description | Rabbit polyclonal ANKRD47 antibody raised against the N terminal Of Ankrd47 |
Gene | KANK3 |
Supplier Page | Shop |