| Name | SCN5A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5112 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | SCN5A antibody was raised using the C terminal of SCN5A corresponding to a region with amino acids FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM |
| Purity/Format | Affinity purified |
| Blocking Peptide | SCN5A Blocking Peptide |
| Description | Rabbit polyclonal SCN5A antibody raised against the C terminal of SCN5A |
| Gene | SCN5A |
| Supplier Page | Shop |