| Name | ALDH4A1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1106 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog, Zebrafish |
| Antigen | ALDH4A1 antibody was raised using the C terminal of ALDH4A1 corresponding to a region with amino acids RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ALDH4A1 Blocking Peptide |
| Description | Rabbit polyclonal ALDH4A1 antibody raised against the C terminal of ALDH4A1 |
| Gene | ALDH3B1 |
| Supplier Page | Shop |