| Name | TROVE2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4760 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGR |
| Purity/Format | Affinity purified |
| Blocking Peptide | TROVE2 Blocking Peptide |
| Description | Rabbit polyclonal TROVE2 antibody raised against the N terminal of TROVE2 |
| Gene | TROVE2 |
| Supplier Page | Shop |