| Name | C12ORF42 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4216 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C12ORF42 antibody was raised using the N terminal Of C12Orf42 corresponding to a region with amino acids PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK |
| Purity/Format | Affinity purified |
| Blocking Peptide | C12ORF42 Blocking Peptide |
| Description | Rabbit polyclonal C12ORF42 antibody raised against the N terminal Of C12Orf42 |
| Gene | C12orf42 |
| Supplier Page | Shop |