| Name | IQCE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3319 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP |
| Purity/Format | Affinity purified |
| Blocking Peptide | IQCE Blocking Peptide |
| Description | Rabbit polyclonal IQCE antibody raised against the middle region of IQCE |
| Gene | IQCE |
| Supplier Page | Shop |