| Name | GJB2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1685 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | GJB2 Blocking Peptide |
| Description | Rabbit polyclonal GJB2 antibody raised against the N terminal of GJB2 |
| Gene | GJB2 |
| Supplier Page | Shop |