| Name | PWWP2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2966 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | PWWP2A antibody was raised using the C terminal of PWWP2A corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR |
| Purity/Format | Affinity purified |
| Blocking Peptide | PWWP2A Blocking Peptide |
| Description | Rabbit polyclonal PWWP2A antibody raised against the C terminal of PWWP2A |
| Gene | PWWP2A |
| Supplier Page | Shop |