SLC25A31 antibody

Name SLC25A31 antibody
Supplier Fitzgerald
Catalog 70R-6470
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen SLC25A31 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP
Purity/Format Affinity purified
Blocking Peptide SLC25A31 Blocking Peptide
Description Rabbit polyclonal SLC25A31 antibody
Gene SLC25A31
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.