Name | NSUN6 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4984 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS |
Purity/Format | Affinity purified |
Blocking Peptide | NSUN6 Blocking Peptide |
Description | Rabbit polyclonal NSUN6 antibody raised against the N terminal of NSUN6 |
Gene | NSUN6 |
Supplier Page | Shop |