| Name | LSAMP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6118 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI |
| Purity/Format | Affinity purified |
| Blocking Peptide | LSAMP Blocking Peptide |
| Description | Rabbit polyclonal LSAMP antibody raised against the N terminal of LSAMP |
| Gene | LSAMP |
| Supplier Page | Shop |