| Name | RNF25 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2806 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | RNF25 antibody was raised using the middle region of RNF25 corresponding to a region with amino acids CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG |
| Purity/Format | Affinity purified |
| Blocking Peptide | RNF25 Blocking Peptide |
| Description | Rabbit polyclonal RNF25 antibody raised against the middle region of RNF25 |
| Gene | RNF25 |
| Supplier Page | Shop |