| Name | RNF175 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1170 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RNF175 antibody was raised using the middle region of RNF175 corresponding to a region with amino acids YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RNF175 Blocking Peptide |
| Description | Rabbit polyclonal RNF175 antibody raised against the middle region of RNF175 |
| Gene | RNF175 |
| Supplier Page | Shop |