RP11-529I10.4 antibody

Name RP11-529I10.4 antibody
Supplier Fitzgerald
Catalog 70R-2998
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen RP11-529I10.4 antibody was raised using the N terminal of RP11-529I10.4 corresponding to a region with amino acids MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK
Purity/Format Affinity purified
Blocking Peptide RP11-529I10.4 Blocking Peptide
Description Rabbit polyclonal RP11-529I10.4 antibody raised against the N terminal of RP11-529I10.4
Gene DPCD
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.