ALAS2 antibody

Name ALAS2 antibody
Supplier Fitzgerald
Catalog 70R-2453
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA
Purity/Format Affinity purified
Blocking Peptide ALAS2 Blocking Peptide
Description Rabbit polyclonal ALAS2 antibody raised against the C terminal of ALAS2
Gene ALAS2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.