| Name | RBM39 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4669 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM39 Blocking Peptide |
| Description | Rabbit polyclonal RBM39 antibody raised against the middle region of RBM39 |
| Gene | RBM39 |
| Supplier Page | Shop |