Name | RBM39 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4669 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE |
Purity/Format | Affinity purified |
Blocking Peptide | RBM39 Blocking Peptide |
Description | Rabbit polyclonal RBM39 antibody raised against the middle region of RBM39 |
Gene | RBM39 |
Supplier Page | Shop |