| Name | RHOT1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5953 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Dog |
| Antigen | RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER |
| Purity/Format | Affinity purified |
| Blocking Peptide | RHOT1 Blocking Peptide |
| Description | Rabbit polyclonal RHOT1 antibody raised against the N terminal of RHOT1 |
| Gene | RHOT1 |
| Supplier Page | Shop |