RHOT1 antibody

Name RHOT1 antibody
Supplier Fitzgerald
Catalog 70R-5953
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Dog
Antigen RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
Purity/Format Affinity purified
Blocking Peptide RHOT1 Blocking Peptide
Description Rabbit polyclonal RHOT1 antibody raised against the N terminal of RHOT1
Gene RHOT1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.