| Name | OR10X1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6539 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | OR10X1 antibody was raised using the middle region of OR10X1 corresponding to a region with amino acids NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP |
| Purity/Format | Affinity purified |
| Blocking Peptide | OR10X1 Blocking Peptide |
| Description | Rabbit polyclonal OR10X1 antibody raised against the middle region of OR10X1 |
| Gene | OR10X1 |
| Supplier Page | Shop |