PSMA4 antibody

Name PSMA4 antibody
Supplier Fitzgerald
Catalog 70R-4317
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PSMA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN
Purity/Format Affinity purified
Blocking Peptide PSMA4 Blocking Peptide
Description Rabbit polyclonal PSMA4 antibody
Gene PSMA4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.