| Name | KIF5B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5599 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | KIF5B antibody was raised using the N terminal of KIF5B corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIF5B Blocking Peptide |
| Description | Rabbit polyclonal KIF5B antibody raised against the N terminal of KIF5B |
| Gene | KIF5B |
| Supplier Page | Shop |