| Name | VDAC2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5053 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV |
| Purity/Format | Affinity purified |
| Blocking Peptide | VDAC2 Blocking Peptide |
| Description | Rabbit polyclonal VDAC2 antibody raised against the N terminal of VDAC2 |
| Gene | VDAC2 |
| Supplier Page | Shop |