Name | ACBD5 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6731 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | ACBD5 antibody was raised using the N terminal of ACBD5 corresponding to a region with amino acids ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK |
Purity/Format | Affinity purified |
Blocking Peptide | ACBD5 Blocking Peptide |
Description | Rabbit polyclonal ACBD5 antibody raised against the N terminal of ACBD5 |
Gene | ACBD5 |
Supplier Page | Shop |