| Name | Semenogelin I antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1593 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Semenogelin I antibody was raised using the C terminal of SEMG1 corresponding to a region with amino acids GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Semenogelin I Blocking Peptide |
| Description | Rabbit polyclonal Semenogelin I antibody raised against the C terminal of SEMG1 |
| Gene | SEMA5B |
| Supplier Page | Shop |