UBE4B antibody

Name UBE4B antibody
Supplier Fitzgerald
Catalog 70R-2330
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen UBE4B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL
Purity/Format Affinity purified
Blocking Peptide UBE4B Blocking Peptide
Description Rabbit polyclonal UBE4B antibody
Gene UBE4A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.