| Name | FAM134B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1786 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | FAM134B antibody was raised using the middle region of Fam134B corresponding to a region with amino acids LSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FAM134B Blocking Peptide |
| Description | Rabbit polyclonal FAM134B antibody raised against the middle region of Fam134B |
| Gene | FAM134B |
| Supplier Page | Shop |