| Name | C1QB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5985 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | C1QB antibody was raised using the C terminal of C1QB corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD |
| Purity/Format | Affinity purified |
| Blocking Peptide | C1QB Blocking Peptide |
| Description | Rabbit polyclonal C1QB antibody raised against the C terminal of C1QB |
| Gene | C1QB |
| Supplier Page | Shop |