GJB4 antibody

Name GJB4 antibody
Supplier Fitzgerald
Catalog 70R-1690
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GJB4 antibody was raised using the middle region of GJB4 corresponding to a region with amino acids CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL
Purity/Format Total IgG Protein A purified
Blocking Peptide GJB4 Blocking Peptide
Description Rabbit polyclonal GJB4 antibody raised against the middle region of GJB4
Gene GJB4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.