| Name | AC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1978 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Drosophila |
| Antigen | AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA |
| Purity/Format | Affinity purified |
| Blocking Peptide | AC Blocking Peptide |
| Description | Rabbit polyclonal AC antibody raised against the N terminal Of Ac |
| Gene | ac |
| Supplier Page | Shop |