| Name | C19orf18 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4541 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C19orf18 antibody was raised using the N terminal of C19orf18 corresponding to a region with amino acids NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK |
| Purity/Format | Affinity purified |
| Blocking Peptide | C19orf18 Blocking Peptide |
| Description | Rabbit polyclonal C19orf18 antibody raised against the N terminal of C19orf18 |
| Gene | C19orf18 |
| Supplier Page | Shop |