Name | VGF antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6219 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | VGF antibody was raised using the middle region of VGF corresponding to a region with amino acids VRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRP |
Purity/Format | Affinity purified |
Blocking Peptide | VGF Blocking Peptide |
Description | Rabbit polyclonal VGF antibody raised against the middle region of VGF |
Gene | VGF |
Supplier Page | Shop |