Name | SDF2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5279 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | SDF2 antibody was raised using the middle region of SDF2 corresponding to a region with amino acids RDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEG |
Purity/Format | Affinity purified |
Blocking Peptide | SDF2 Blocking Peptide |
Description | Rabbit polyclonal SDF2 antibody raised against the middle region of SDF2 |
Gene | SDF2 |
Supplier Page | Shop |