Name | Chondroadherin antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5471 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL |
Purity/Format | Affinity purified |
Blocking Peptide | Chondroadherin Blocking Peptide |
Description | Rabbit polyclonal Chondroadherin antibody raised against the middle region of CHAD |
Gene | CHAD |
Supplier Page | Shop |