| Name | CAV1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2555 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL |
| Purity/Format | Affinity purified |
| Blocking Peptide | CAV1 Blocking Peptide |
| Description | Rabbit polyclonal CAV1 antibody raised against the N terminal of CAV1 |
| Gene | CAV2 |
| Supplier Page | Shop |