| Name | ETFB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2458 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP |
| Purity/Format | Affinity purified |
| Blocking Peptide | ETFB Blocking Peptide |
| Description | Rabbit polyclonal ETFB antibody raised against the C terminal of ETFB |
| Gene | ETFB |
| Supplier Page | Shop |