Name | C14ORF180 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6443 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | C14ORF180 antibody was raised using the N terminal Of C14Orf180 corresponding to a region with amino acids EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA |
Purity/Format | Affinity purified |
Blocking Peptide | C14ORF180 Blocking Peptide |
Description | Rabbit polyclonal C14ORF180 antibody raised against the N terminal Of C14Orf180 |
Gene | C14orf180 |
Supplier Page | Shop |