Name | C20ORF3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1818 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | C20ORF3 antibody was raised using the C terminal Of C20Orf3 corresponding to a region with amino acids QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | C20ORF3 Blocking Peptide |
Description | Rabbit polyclonal C20ORF3 antibody raised against the C terminal Of C20Orf3 |
Gene | APMAP |
Supplier Page | Shop |