Name | IGSF9 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7213 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA |
Purity/Format | Affinity purified |
Blocking Peptide | IGSF9 Blocking Peptide |
Description | Rabbit polyclonal IGSF9 antibody raised against the N terminal of IGSF9 |
Gene | IGSF9 |
Supplier Page | Shop |