ZADH2 antibody

Name ZADH2 antibody
Supplier Fitzgerald
Catalog 70R-4445
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ZADH2 antibody was raised using the N terminal of ZADH2 corresponding to a region with amino acids MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT
Purity/Format Affinity purified
Blocking Peptide ZADH2 Blocking Peptide
Description Rabbit polyclonal ZADH2 antibody raised against the N terminal of ZADH2
Gene ZADH2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.