GABRA3 antibody

Name GABRA3 antibody
Supplier Fitzgerald
Catalog 70R-1528
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen GABRA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
Purity/Format Total IgG Protein A purified
Blocking Peptide GABRA3 Blocking Peptide
Description Rabbit polyclonal GABRA3 antibody
Gene GABRA3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.