| Name | TTC12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3356 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | TTC12 antibody was raised using the C terminal of TTC12 corresponding to a region with amino acids MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK |
| Purity/Format | Affinity purified |
| Blocking Peptide | TTC12 Blocking Peptide |
| Description | Rabbit polyclonal TTC12 antibody raised against the C terminal of TTC12 |
| Gene | TTC12 |
| Supplier Page | Shop |