| Name | PIGT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7406 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PIGT antibody was raised using the N terminal of PIGT corresponding to a region with amino acids PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIGT Blocking Peptide |
| Description | Rabbit polyclonal PIGT antibody raised against the N terminal of PIGT |
| Gene | PIGT |
| Supplier Page | Shop |