Name | PIGT antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7406 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | PIGT antibody was raised using the N terminal of PIGT corresponding to a region with amino acids PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL |
Purity/Format | Affinity purified |
Blocking Peptide | PIGT Blocking Peptide |
Description | Rabbit polyclonal PIGT antibody raised against the N terminal of PIGT |
Gene | PIGT |
Supplier Page | Shop |