TKT antibody

Name TKT antibody
Supplier Fitzgerald
Catalog 70R-2587
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen TKT antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL
Purity/Format Affinity purified
Blocking Peptide TKT Blocking Peptide
Description Rabbit polyclonal TKT antibody
Gene TKT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.