| Name | SLC25A46 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6512 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | SLC25A46 antibody was raised using the C terminal of SLC25A46 corresponding to a region with amino acids LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC25A46 Blocking Peptide |
| Description | Rabbit polyclonal SLC25A46 antibody raised against the C terminal of SLC25A46 |
| Gene | SLC25A46 |
| Supplier Page | Shop |